PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G196000.1.p
Common NameSb02g024250, SORBIDRAFT_02g024250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 288aa    MW: 31859.8 Da    PI: 4.7392
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G196000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49.4e-151461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT eEd++lv      G  +W+++++  g+ R++k+c++rw +yl
  Sobic.002G196000.1.p 14 RGPWTVEEDQKLVTFLLTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                          89******************************99************97 PP

2Myb_DNA-binding52.98.8e-1770111447
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            + eE+   +d+++qlG++ W++Ia+ ++ gRt++++k++w+++
  Sobic.002G196000.1.p  70 LSSEEERTVIDLHEQLGNR-WSKIASQLP-GRTDNEIKNHWNTH 111
                           589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-19562IPR009057Homeodomain-like
PROSITE profilePS5129413.384961IPR017930Myb domain
SuperFamilySSF466894.87E-2711108IPR009057Homeodomain-like
SMARTSM007171.2E-111363IPR001005SANT/Myb domain
PfamPF002491.7E-131461IPR001005SANT/Myb domain
CDDcd001671.90E-81661No hitNo description
PROSITE profilePS5129426.42862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2463116IPR009057Homeodomain-like
SMARTSM007178.2E-1566114IPR001005SANT/Myb domain
CDDcd001672.29E-1171112No hitNo description
PfamPF002492.5E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRQPCCAKV GLKRGPWTVE EDQKLVTFLL TNGHCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDVKRGLL SSEEERTVID LHEQLGNRWS KIASQLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPVTHKPLH QPASPPPPPP LTRQEQEEKD TGGSPEEEEE EEIVTAITAG HDASCTDEVP  180
MALLLDDMDI VLPGDDVVGA QAAACVGTVY SPESSSSSSS YSASAAALSG GSSSSSVDGE  240
CPDWLPMMDW PEPIWQLEDV VTARTPWEFE DPFVYQRIAL FDHQETF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4741310.0AF474131.1 Sorghum bicolor typical P-type R2R3 Myb protein (Myb54) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460189.10.0hypothetical protein SORBIDRAFT_02g024250
SwissprotQ50EX66e-81ODO1_PETHY; Protein ODORANT1
TrEMBLC5XC550.0C5XC55_SORBI; Putative uncharacterized protein Sb02g024250
STRINGSb02g024250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.11e-83myb domain protein 43